PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G35040.1
Common NamebZIP19, M4E13.100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 261aa    MW: 28665.8 Da    PI: 5.6038
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G35040.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.15.9e-1191138552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  k e+r   NReA r++R++Kka+ + Le++v+ L a N++L k+l++ 
  AT4G35040.1  91 KGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQ 138
                  6799999***********************************999863 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-1187154IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.86489155IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-1390155No hitNo description
SuperFamilySSF579596.06E-791138No hitNo description
PfamPF077162.9E-1491144IPR004827Basic-leucine zipper domain
CDDcd146861.92E-1293146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEDGELDFSN QEVFSSSEMG ELPPSNCSMD SFFDGLLMDT NAACTHTHTC NPTGPENTHT  60
HTCFHVHTKI LPDESDEKVS TDDTAESCGK KGEKRPLGNR EAVRKYREKK KAKAASLEDE  120
VARLRAVNQQ LVKRLQNQAT LEAEVSRLKC LLVDLRGRID GEIGSFPYQK PMAANIPSFS  180
HMMNPCNVQC DDEVYCPQNV FGVNSQEGAS INDQGLSGCD FDQLQCMANQ NLNGNGNGSF  240
SNVNTSVSNK RKGGHRASRA V
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.314510.0flower| inflorescence
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865163980.0
Genevisible253171_at0.0
Expression AtlasAT4G35040-
AtGenExpressAT4G35040-
ATTED-IIAT4G35040-
Functional Description ? help Back to Top
Source Description
TAIRBasic-region leucine zipper (bZIP19) transcription factor involved in the adaptation to zinc deficiency. Binds ZDRE motifs.
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Function -- GeneRIF ? help Back to Top
  1. Studies indicate that zinc deficiency leads to the activation of bZIP9 and bZIP23.
    [PMID: 23851954]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G35040.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions (PubMed:20479230, PubMed:26306426). Mutant seedlings grown under normal conditions accumulate reduced levels of zinc in roots. Mutant seedlings grown in zinc-depleted medium have reduced root length (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G35040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0723860.0AY072386.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
GenBankBT0001600.0BT000160.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567974.10.0transcription factor bZIP19
SwissprotQ8VY760.0BZP19_ARATH; Basic leucine zipper 19
TrEMBLD7MDG40.0D7MDG4_ARALL; BZIP transcription factor family protein
STRINGAT4G35040.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Representative plantOGRP19701536
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  5. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  6. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  7. Assun
    Arabidopsis thaliana transcription factors bZIP19 and bZIP23 regulate the adaptation to zinc deficiency.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(22): p. 10296-301
    [PMID:20479230]
  8. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  9. Assun
    Model of how plants sense zinc deficiency.
    Metallomics, 2013. 5(9): p. 1110-6
    [PMID:23851954]
  10. Inaba S, et al.
    Identification of putative target genes of bZIP19, a transcription factor essential for Arabidopsis adaptation to Zn deficiency in roots.
    Plant J., 2015. 84(2): p. 323-34
    [PMID:26306426]